GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
0 items
New Products
Product Details
Turkey Bites
Turkey Bites
Units in Stock
7
Brand:Pero
Product Code:DOG_PER_TUR_BIT
weight:200.0g
Product Condition:New
£7.49 inc. tax
Add to Cart
Description
Tasty, healthy, and suitable for sensitive dogs with food allergies, be assured your dog will love our turkey bites. These treats are high in protein and suitable for dogs of all ages (Puppy to Senior). They're also a great choice for dogs who have intolerances.
  • Ingredients: 100% Turkey
  • Analytical Constituents: Raw Protein: 49.0%, Raw Fat: 30.0%, Raw Ash: 8.0%, Raw Fibre: 1.0%, Moisture: 12.0% 
  • Pack Size: 200g
  • Feeding Guide: Treats should be used sparingly between mealtimes. If you plan to use treats regularly make sure to adjust how much you feed at mealtimes to avoid over-feeding your four-legged friend.
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------