GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
0 items
New Products
Product Details
Rabbit Meat Chews
Rabbit Meat Chews
Units in Stock
10
Brand:Debs Dog Food
Product Code:RAB_MEA_CHE
weight:100.0g
Product Condition:New
£5.49 inc. tax
Add to Cart
Description
Our 100g bags of rabbit meat chews are made from 100% human grade rabbit meat that are naturally air-dried then sliced into strips. These treats make a nice yummy high in protein snack for your pooches which are also low in fat and hypoallergenic.
  • Composition: 100% Rabbit Meat
  • Nutritional Analysis: Crude Protein: 38.9%, Crude Oils / Fats: 17.3%, Moisture: 8.3%, Crude Ash: 2.9%, Fibre: 2%
  • Storage: Please keep in a dry and cool place away from any direct sunlight / heat sources.
  • Feeding Guide: Complementary feeds for dogs. Suitable for dogs from 8+ weeks. 
  • Not suitable for human consumption.
  • Please ensure your dog has plenty of fresh water daily.
  • Supervision on all natural treats advised. 
  • Although much care is taken when producing natural treats, some small bone particles may appear in some treats which are safe for your dog to consume.
Product Added to your Cart
x

-------- OR --------