GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
0 items
New Products
Product Details
Goat Softies
Goat Softies
Units in Stock
6
Brand:Debs Dog Food
Product Code:GOA_SOF
weight:200.0g
Product Condition:New
£3.99 inc. tax
Add to Cart
Description
Our 200g bags of goat softies are flat and soft with high protein content.  They're suitable for all breeds and puppies from 8+ weeks and can be fed whole or broken up into smaller strip pieces.  (Approx. 20 soft strips)
  • Composition: 100% Goat
  • Nutritional Analysis: Crude Protein: 72%, Crude Oils / Fats: 6%, Moisture: 15%, Crude Ash: 2%, Fibre: 5%
  • Storage: Please keep in a dry and cool place away from any direct sunlight / heat sources.
  • Feeding Guide: Complementary feeds for dogs. Suitable for dogs from 8+ weeks. 
  • Not suitable for human consumption.
  • Please ensure your dog has plenty of fresh water daily.
  • Supervision on all natural treats advised. 
  • Although much care is taken when producing natural treats, some small bone particles may appear in some treats which are safe for your dog to consume.
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------