GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
0 items
New Products
Product Details
Tripe Jerky Sticks
Tripe Jerky Sticks
Units in Stock
8
Brand:Debs Dog Food
Product Code:TRI_JER_STI
weight:200.0g
Product Condition:New
£3.99 inc. tax
Add to Cart
Description
These come in a bag with approx. 20 Natural Beef Tripe Jerky sticks (200g)
These are quite soft so can be broken up into smaller pieces or fed as 1 whole stick.
  • Composition: 100% Beef
  • Nutritional Analysis: Crude Protein: 80.5%, Crude Oils / Fats: 3.5%, Moisture: 10%, Crude Ash: 3%, Fibre: 3%
  • Storage: Please keep in a dry and cool place away from any direct sunlight / heat sources.
  • Feeding Guide: Complementary feeds for dogs. Suitable for dogs from 8+ weeks. 
  • Not suitable for human consumption.
  • Please ensure your dog has plenty of fresh water daily.
  • Supervision on all natural treats advised.
  • Although much care is taken when producing natural treats, some small bone particles may appear in some treats which are safe for your dog to consume.

Product Added to your Cart
x

-------- OR --------